DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CYP71

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_190046.2 Gene:CYP71 / 823585 AraportID:AT3G44600 Length:631 Species:Arabidopsis thaliana


Alignment Length:154 Identity:70/154 - (45%)
Similarity:101/154 - (65%) Gaps:5/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGESIY 79
            |::.||:|||.::|:..||||...||...|..|||.|..|||:::||::|.|||.||||||:||:
plant   478 VIMHTTLGDIHMKLYPEECPKTVENFTTHCRNGYYDNHLFHRVIRGFMIQTGDPLGDGTGGQSIW 542

  Fly    80 GQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIYNML 142
            |:.|:||||..||:.|...:.|||:|.:.||||||.|...||.|.||:|:||::..  |.:..:.
plant   543 GREFEDEFHKSLRHDRPFTLSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVKGMDVVQGIE 607

  Fly   143 KLEDGIVDHQERPMHAHRIVSTEV 166
            |::   .|..:||....:|::..|
plant   608 KVK---TDKNDRPYQDVKILNVTV 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 70/154 (45%)
CYP71NP_190046.2 WD40 <68..286 CDD:295369
WD40 <69..>287 CDD:225201
WD40 repeat 73..111 CDD:293791
WD40 repeat 117..154 CDD:293791
WD40 repeat 157..200 CDD:293791
WD40 repeat 207..253 CDD:293791
cyclophilin_WD40 479..626 CDD:238908 68/149 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.