DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CYP71

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_190046.2 Gene:CYP71 / 823585 AraportID:AT3G44600 Length:631 Species:Arabidopsis thaliana


Alignment Length:154 Identity:70/154 - (45%)
Similarity:101/154 - (65%) Gaps:5/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGESIY 79
            |::.||:|||.::|:..||||...||...|..|||.|..|||:::||::|.|||.||||||:||:
plant   478 VIMHTTLGDIHMKLYPEECPKTVENFTTHCRNGYYDNHLFHRVIRGFMIQTGDPLGDGTGGQSIW 542

  Fly    80 GQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIYNML 142
            |:.|:||||..||:.|...:.|||:|.:.||||||.|...||.|.||:|:||::..  |.:..:.
plant   543 GREFEDEFHKSLRHDRPFTLSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVKGMDVVQGIE 607

  Fly   143 KLEDGIVDHQERPMHAHRIVSTEV 166
            |::   .|..:||....:|::..|
plant   608 KVK---TDKNDRPYQDVKILNVTV 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 70/154 (45%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
CYP71NP_190046.2 WD40 <68..286 CDD:475233
WD40 repeat 73..111 CDD:293791
WD40 repeat 117..154 CDD:293791
WD40 repeat 157..200 CDD:293791
WD40 repeat 207..253 CDD:293791
cyclophilin_WD40 479..626 CDD:238908 68/149 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.