DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and AT3G22920

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_188932.1 Gene:AT3G22920 / 821864 AraportID:AT3G22920 Length:232 Species:Arabidopsis thaliana


Alignment Length:266 Identity:62/266 - (23%)
Similarity:100/266 - (37%) Gaps:76/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVLLKTTV-----GDIDIELWARECPKACRNFVQLCL--EG--------YYKNTEFHRLVKGFIV 63
            ||....||     |.|.|||:|...|:...||..||.  .|        :||.:.|..:|...:.
plant     5 KVFFDLTVDGKPAGRIVIELFADLTPRTAENFRGLCTGERGIGKCGKPIHYKGSTFDHIVPDLMW 69

  Fly    64 QGGDPNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNT 128
            .|||...:   .|.|:.:...||:.........|::.||    |.|||||        ::..|: 
plant    70 CGGDIIFE---NEPIHSEELDDEYFILNHEDGPGIISMA----DSNGSQF--------QIHMKD- 118

  Fly   129 LFG-KITGDTIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDDIVPRILSQPSTKSKKTKKE 192
             :| ::.||.:. :.|:.:|:                        |::..|..:..|.:.:|..:
plant   119 -YGLQVDGDHVV-IGKVVEGL------------------------DLMRNIEKEVITTTTRTPSK 157

  Fly   193 RQGVKNFGLLSFGEEAEGDEEETNVYVKQNAGKAKSLHDVTDDPKLSKEPIRVPKVEKADIEEHL 257
            ...:.:.|.||       |......|:.:|..|...:....|:     :|:.:     ||. ..|
plant   158 PVVIADCGELS-------DYRSERCYLMKNIEKEVIIKTAKDN-----KPVVI-----ADC-GGL 204

  Fly   258 SDDCPE 263
            |||..|
plant   205 SDDRSE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 43/179 (24%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
AT3G22920NP_188932.1 cyclophilin 1..168 CDD:469651 47/204 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.