DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and AT2G36130

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_181157.1 Gene:AT2G36130 / 818186 AraportID:AT2G36130 Length:164 Species:Arabidopsis thaliana


Alignment Length:162 Identity:75/162 - (46%)
Similarity:107/162 - (66%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGT 73
            ||   :|.|:|::|...:|::.:..|:.||||::|...|||.|..|||:||.||||||||.|.|.
plant     9 PP---EVTLETSMGPFTVEMYYKHSPRTCRNFLELSRRGYYDNVLFHRIVKDFIVQGGDPTGTGR 70

  Fly    74 GGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI-TGDT 137
            |||||||..|:||.:..|::|..|::.|||:|.:.||||||.|.||.|.|..|:|:||:: .|..
plant    71 GGESIYGSKFEDEINKELKHTGAGILSMANAGPNTNGSQFFITLAPQPSLDGKHTIFGRVCRGME 135

  Fly   138 IYNMLKLEDGIV--DHQERPMHAHRIVSTEVL 167
            :...|    |.|  |:.:||:|..:|:.|:|:
plant   136 VIKRL----GSVQTDNTDRPIHEVKILRTKVI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 75/162 (46%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
AT2G36130NP_181157.1 cyclophilin 13..159 CDD:469651 70/149 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.