DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and AT2G36130

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_181157.1 Gene:AT2G36130 / 818186 AraportID:AT2G36130 Length:164 Species:Arabidopsis thaliana


Alignment Length:162 Identity:75/162 - (46%)
Similarity:107/162 - (66%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGT 73
            ||   :|.|:|::|...:|::.:..|:.||||::|...|||.|..|||:||.||||||||.|.|.
plant     9 PP---EVTLETSMGPFTVEMYYKHSPRTCRNFLELSRRGYYDNVLFHRIVKDFIVQGGDPTGTGR 70

  Fly    74 GGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI-TGDT 137
            |||||||..|:||.:..|::|..|::.|||:|.:.||||||.|.||.|.|..|:|:||:: .|..
plant    71 GGESIYGSKFEDEINKELKHTGAGILSMANAGPNTNGSQFFITLAPQPSLDGKHTIFGRVCRGME 135

  Fly   138 IYNMLKLEDGIV--DHQERPMHAHRIVSTEVL 167
            :...|    |.|  |:.:||:|..:|:.|:|:
plant   136 VIKRL----GSVQTDNTDRPIHEVKILRTKVI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 75/162 (46%)
AT2G36130NP_181157.1 cyclophilin 13..159 CDD:412213 70/149 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.