DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and AT2G21130

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_179709.1 Gene:AT2G21130 / 816648 AraportID:AT2G21130 Length:174 Species:Arabidopsis thaliana


Alignment Length:136 Identity:54/136 - (39%)
Similarity:77/136 - (56%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVLLKTTV-----GDIDIELWARECPKACRNFVQLCL--EG--------YYKNTEFHRLVKGFIV 63
            ||....|:     |.|.:||:..:.||...||..||.  :|        ::|.:.|||::..|:.
plant     6 KVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSFHRVIPNFMC 70

  Fly    64 QGGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKN 127
            |||| ..|:|||||||||..|:||...| ::|..|::.|||:|.:.||||||.....|..|..|:
plant    71 QGGDFTKGNGTGGESIYGAKFEDENFER-KHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKH 134

  Fly   128 TLFGKI 133
            .:||::
plant   135 VVFGQV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 54/136 (40%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
AT2G21130NP_179709.1 cyclophilin_ABH_like 5..170 CDD:238907 54/136 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.