DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and PPIAL4F

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001157734.2 Gene:PPIAL4F / 728945 HGNCID:33999 Length:164 Species:Homo sapiens


Alignment Length:139 Identity:58/139 - (41%)
Similarity:81/139 - (58%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNIYIQEPPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFI 62
            ::::...|....||.|     |.|.|:|:|.:.||...||..|..  :|: ||.:.|||::.||:
Human     2 VNSVVFFEITRDGKPL-----GRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFM 61

  Fly    63 VQGGD---PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQ 124
            .||||   ||  |||.:||||:.|.||...| ::|..|::.|||:|.:.||||||...|.|..|.
Human    62 CQGGDFTRPN--GTGDKSIYGEKFDDENLIR-KHTGSGILSMANAGPNTNGSQFFICAAKTEWLD 123

  Fly   125 NKNTLFGKI 133
            .|:..|||:
Human   124 GKHVAFGKV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 58/132 (44%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
PPIAL4FNP_001157734.2 cyclophilin 4..162 CDD:469651 58/137 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.