DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and Ppil1

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_081121.1 Gene:Ppil1 / 68816 MGIID:1916066 Length:166 Species:Mus musculus


Alignment Length:158 Identity:72/158 - (45%)
Similarity:105/158 - (66%) Gaps:10/158 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EPPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDG 72
            :||   .|.|:|::|.|.:||:.:..||.|:||.:|...|||..|:|||::|.|::|||||.|.|
Mouse    10 QPP---NVYLETSMGVIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTG 71

  Fly    73 TGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI-TGD 136
            .||.||||:.|:||.|..|::|..|::.|||:|.|.||||||.|.|||..|..|:|:||:: .|.
Mouse    72 RGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGI 136

  Fly   137 TIYNMLKLEDGIVD--HQERPMHAHRIV 162
            .:.|.:    |:|:  .|:||:...:|:
Mouse   137 GMVNRV----GMVETNSQDRPVDDVKIL 160

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 72/158 (46%)
Ppil1NP_081121.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 69/150 (46%)
Cyclosporin A binding. /evidence=ECO:0000250 54..65 5/10 (50%)