DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and Ppid

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_080628.1 Gene:Ppid / 67738 MGIID:1914988 Length:370 Species:Mus musculus


Alignment Length:391 Identity:106/391 - (27%)
Similarity:174/391 - (44%) Gaps:111/391 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGDIDIELWARECPKACRNFVQLCL--EG---------YYKNTEFHRLVKGFIVQGGD-PNGDGT 73
            ||.|.:||:|...||...||..||.  :|         ::|...|||::|.|::|||| .|.:||
Mouse    29 VGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGT 93

  Fly    74 GGESIYGQPFKDE-FHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI---- 133
            |||||||:.|:|| ||  .::.|.||:.|||:|.:.||||||.|..|||.|..|:.:||::    
Mouse    94 GGESIYGEKFEDENFH--YKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGL 156

  Fly   134 -TGDTIYNM-------LKL-------------------EDGIVD-HQERPMHAHRIVSTEVLSNP 170
             ...|:.|:       .||                   :||..| |.:.|..|      ::....
Mouse   157 GVARTLENVEVNGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDA------DIDLKD 215

  Fly   171 FDDIVPRILSQPSTKSKKTKKERQGVKNFGLLSFGEEAEGDEEETNVYVK--QNAGKAKSLHDVT 233
            .|.|:  ::|             :.:||.|...|  :::..|.....|.|  :....:|::.:..
Mouse   216 VDKIL--LIS-------------EDLKNIGNTFF--KSQNWEMAIKKYAKVLRYVDSSKAVIEKA 263

  Fly   234 DDPKLSKEPIRVP--------KVEKADIEEHLSDDCPEDSVKDKPSTASSDLIKMKLSKRSKSGA 290
            |..:|  :||.:.        |::.::.:..: |.|.|....|..:|.:       |.::::...
Mouse   264 DRSRL--QPIALSCVLNIGACKLKMSNWQGAI-DSCLEALEMDPSNTKA-------LYRKAQGWQ 318

  Fly   291 DKKVQPVEEKSDSEDDEDVLLTREEEQSRKVSEEKSKIREEIASLKKQYQMDKQSKDKLVNGQEK 355
            ..|          |.|:.:   .:.:::::::.....|:.|:..:|   ||.|..|||     ||
Mouse   319 GLK----------EYDQAL---ADLKKAQEIAPGDKAIQAELLKVK---QMIKAQKDK-----EK 362

  Fly   356 A 356
            |
Mouse   363 A 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 71/201 (35%)
PpidNP_080628.1 cyclophilin_ABH_like 16..182 CDD:238907 63/154 (41%)
Chaperone activity. /evidence=ECO:0000250 185..215 6/35 (17%)
Interaction with HSP90AB1. /evidence=ECO:0000250 214..370 37/198 (19%)
TPR_11 223..304 CDD:290150 17/98 (17%)
TPR repeat 223..251 CDD:276809 8/42 (19%)
TPR repeat 272..302 CDD:276809 4/30 (13%)
TPR_11 277..338 CDD:290150 10/81 (12%)
TPR 277..306 CDD:197478 5/29 (17%)
TPR repeat 307..335 CDD:276809 5/47 (11%)
TPR_1 308..340 CDD:278916 4/51 (8%)
TPR repeat 341..364 CDD:276809 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.