Sequence 1: | NP_648508.1 | Gene: | CG10907 / 39331 | FlyBaseID: | FBgn0036207 | Length: | 502 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006522510.1 | Gene: | Ppil2 / 66053 | MGIID: | 2447857 | Length: | 564 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 81/207 - (39%) |
---|---|---|---|
Similarity: | 115/207 - (55%) | Gaps: | 22/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 GKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGES 77
Fly 78 IYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIYN 140
Fly 141 MLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDDIVPRI------------------LSQPSTKSK 187
Fly 188 KTKKERQGVKNF 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10907 | NP_648508.1 | cyclophilin_CeCYP16-like | 8..178 | CDD:238906 | 73/166 (44%) |
Ppil2 | XP_006522510.1 | RING-Ubox_PPIL2 | 38..110 | CDD:319577 | |
RING_Ubox | 100..159 | CDD:388418 | |||
U-box domain, a modified RING finger | 103..146 | CDD:319361 | |||
cyclophilin_RING | 281..440 | CDD:238904 | 72/160 (45%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1392223at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |