DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and Ppil2

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_006522510.1 Gene:Ppil2 / 66053 MGIID:2447857 Length:564 Species:Mus musculus


Alignment Length:207 Identity:81/207 - (39%)
Similarity:115/207 - (55%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGES 77
            |.|.|.|..||:::||.....||.|.||::||.:.||..|.|||.::.|::|||||.|.||||||
Mouse   280 GYVRLHTNKGDLNLELHCDLTPKTCENFIKLCKKQYYDGTIFHRSIRNFVIQGGDPTGTGTGGES 344

  Fly    78 IYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIYN 140
            .:|:||||||...|.:|.||::.|||||.:.|.||||.||.....|..|:|:||::.|  ||:..
Mouse   345 FWGKPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFRSCAYLDKKHTIFGRVVGGFDTLTA 409

  Fly   141 MLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDDIVPRI------------------LSQPSTKSK 187
            |..:|..  ...:||.....|.:|.|..:|:::...:|                  :|||...::
Mouse   410 MENVESD--PKTDRPKEEVLICTTTVFVDPYEEADAQIAQERKKTQHQVDPEAKVKMSQPQPGNQ 472

  Fly   188 KTKKERQGVKNF 199
            ..:..||||..:
Mouse   473 GPQTYRQGVGKY 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 73/166 (44%)
Ppil2XP_006522510.1 RING-Ubox_PPIL2 38..110 CDD:319577
RING_Ubox 100..159 CDD:388418
U-box domain, a modified RING finger 103..146 CDD:319361
cyclophilin_RING 281..440 CDD:238904 72/160 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.