DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and PPIAL4G

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001116540.1 Gene:PPIAL4G / 644591 HGNCID:33996 Length:164 Species:Homo sapiens


Alignment Length:119 Identity:53/119 - (44%)
Similarity:73/119 - (61%) Gaps:9/119 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQGGD---PNGDGTGGESIY 79
            :|.|.|:.:|.:.||...||..|..  :|: ||.:.|||::.||:.||||   ||  |||.:|||
Human    17 LGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTHPN--GTGDKSIY 79

  Fly    80 GQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI 133
            |:.|.||...| ::|..|::.|||:|.:.||||||...|.|..|..|:..|||:
Human    80 GEKFDDENLIR-KHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGKV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 53/119 (45%)
PPIAL4GNP_001116540.1 cyclophilin 4..162 CDD:294131 53/119 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.