DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and ZC250.5

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001123073.1 Gene:ZC250.5 / 6418817 WormBaseID:WBGene00045306 Length:204 Species:Caenorhabditis elegans


Alignment Length:104 Identity:24/104 - (23%)
Similarity:44/104 - (42%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YKNTEFHRL-VKGFIVQGGDP-NGDGTG-----GESIYGQPFKDEFHSRLRYTRRGLVGMANSGK 106
            |..|..|:: ....::.|||. ||:|.|     ...::.:   :.|.|.::.||..::.:.:   
 Worm    82 YTGTILHQISTSKNMIMGGDVLNGNGCGRCAPVSRKLFQE---NNFSSTVQNTRGKVILLPS--- 140

  Fly   107 DDNGSQFFFTFAPTPELQNKNTLFGKITGDTIYNMLKLE 145
            |.|.:.|...|....:....:.:.|...||.|..:..||
 Worm   141 DTNPTVFSSLFYVLLDKSGPSVVDGCPIGDVIEGIEILE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 24/104 (23%)
ZC250.5NP_001123073.1 cyclophilin 44..200 CDD:381853 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.