DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and ppil1

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001029350.1 Gene:ppil1 / 558042 ZFINID:ZDB-GENE-051009-1 Length:166 Species:Danio rerio


Alignment Length:164 Identity:76/164 - (46%)
Similarity:108/164 - (65%) Gaps:10/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EPPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDG 72
            :|||   |.|.||:|.|.:||:....||.|:||.:|...|||.:|:|||::|.|:||||||.|.|
Zfish    10 QPPT---VSLDTTMGTIVLELYWNHAPKTCKNFAELGRRGYYNSTKFHRIIKDFMVQGGDPTGTG 71

  Fly    73 TGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI-TGD 136
            .||.||||:.|:||||..|::|..|::.|||:|.|.||||||.:.|||..|..|:|:||:: .|.
Zfish    72 RGGASIYGKQFEDEFHPELKFTGAGILAMANAGPDTNGSQFFLSLAPTQWLDGKHTIFGRVCQGI 136

  Fly   137 TIYNMLKLEDGIVD--HQERPMHAHRIVSTEVLS 168
            .:.|.:    |:|:  .|:||:...:|:...:.|
Zfish   137 GVLNRI----GMVETNSQDRPVDDIKILRVNLPS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 76/164 (46%)
ppil1NP_001029350.1 cyclophilin 16..161 CDD:294131 71/148 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.