DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and PPIB

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_000933.1 Gene:PPIB / 5479 HGNCID:9255 Length:216 Species:Homo sapiens


Alignment Length:157 Identity:65/157 - (41%)
Similarity:96/157 - (61%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPTSGKVLLKTTVGDIDI-----ELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQG 65
            |..:.||.....:||.|:     .|:.:..||...|||.|..  :|: |||::|||::|.|::||
Human    40 PKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQG 104

  Fly    66 GD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTL 129
            || ..||||||:||||:.|.|| :.:|::...|.|.|||:|||.||||||.|...|..|..|:.:
Human   105 GDFTRGDGTGGKSIYGERFPDE-NFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVV 168

  Fly   130 FGKITGDTIYNMLKLEDGIVDHQERPM 156
            |||:. :.:..:.|:|....|.:::|:
Human   169 FGKVL-EGMEVVRKVESTKTDSRDKPL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 65/157 (41%)
PPIBNP_000933.1 cyclophilin_ABH_like 45..203 CDD:238907 64/152 (42%)
Prevents secretion from ER 213..216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.