DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and PPIL3

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_115861.1 Gene:PPIL3 / 53938 HGNCID:9262 Length:165 Species:Homo sapiens


Alignment Length:177 Identity:60/177 - (33%)
Similarity:84/177 - (47%) Gaps:36/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGD-------PNG-- 70
            |.|.|.||||.||::....||.|.      :|.        |.|....||..|       |.|  
Human     3 VTLHTDVGDIKIEVFCERTPKTCE------MES--------RCVPQAGVQWRDLGSLQPPPPGFK 53

  Fly    71 ---------DGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNK 126
                     .|.||.||:|:.|:||:...|::..||:|.|||:|.:.||||||.|:...|.|..|
Human    54 QVFCLSLPRTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMK 118

  Fly   127 NTLFGKITG--DTIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSNPF 171
            .|:|||:..  :|:..:.||.  :.:...||::...|....:.:|||
Human   119 YTVFGKVIDGLETLDELEKLP--VNEKTYRPLNDVHIKDITIHANPF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 60/177 (34%)
PPIL3NP_115861.1 cyclophilin 1..158 CDD:294131 57/170 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.