DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and ppil3

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001002146.1 Gene:ppil3 / 415236 ZFINID:ZDB-GENE-040625-159 Length:161 Species:Danio rerio


Alignment Length:159 Identity:74/159 - (46%)
Similarity:101/159 - (63%) Gaps:4/159 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGESIY 79
            |.|.|.:||:.|||:..:.||:|.||:.||..|:|....|||.:||||||.|||.|.|.||.||:
Zfish     3 VTLHTDLGDMKIELFCEKAPKSCENFLALCAGGFYNGCIFHRNIKGFIVQTGDPTGTGKGGTSIW 67

  Fly    80 GQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIYNML 142
            |:.|:|||...|::..||:|.|||:|.:.|.||||||:|..|.|..|.|:||||..  :|:..:.
Zfish    68 GRKFEDEFSEHLKHNVRGVVAMANNGPNTNASQFFFTYAKQPHLDMKYTVFGKIIDGLETLDEIE 132

  Fly   143 KLEDGIVDHQERPMHAHRIVSTEVLSNPF 171
            ||.  :.:...||::..||....:.:|||
Zfish   133 KLP--VNEKTFRPLNDVRIKDVTIHANPF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 74/159 (47%)
ppil3NP_001002146.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 71/152 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.