DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CG7768

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster


Alignment Length:175 Identity:63/175 - (36%)
Similarity:87/175 - (49%) Gaps:40/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQGGD-PNGDGTGGESIYGQ 81
            :|.|.:||.:...||...||..||.  :|| ||.:.|||::..|:.|||| .|.:||||.||||.
  Fly    17 LGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGN 81

  Fly    82 PFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITGDTIYNMLKLED 146
            .|.|| :..|::|..|::.|||:|.:.||||||.....|..|.||:.:|||:.           :
  Fly    82 KFPDE-NFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVV-----------E 134

  Fly   147 GIVDHQERPMHAHRIVSTEVLSNPFDDIVPRILSQPSTKSKKTKK 191
            |:                        |||.::.|..|...|.:||
  Fly   135 GM------------------------DIVQKVESYGSQDGKTSKK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 58/160 (36%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 63/175 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.