DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and ppia

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_988875.1 Gene:ppia / 394470 XenbaseID:XB-GENE-5778000 Length:164 Species:Xenopus tropicalis


Alignment Length:130 Identity:59/130 - (45%)
Similarity:81/130 - (62%) Gaps:7/130 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQGGD-PNGDGTGGESIYGQ 81
            :|.|.:||.:...||...||..||.  :|: |||:.|||::..|:.|||| .|.:||||:||||.
 Frog    17 MGRIIMELRSDVVPKTAENFRALCTNEKGFGYKNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGN 81

  Fly    82 PFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIYNMLKL 144
            .|.|| :.:||:|..|::.|||:|.:.||||||...|.|..|..|:.:||.:..  |.:.||.||
 Frog    82 KFADE-NFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTVIDGMDVVRNMEKL 145

  Fly   145  144
             Frog   146  145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 59/130 (45%)
ppiaNP_988875.1 cyclophilin_ABH_like 4..162 CDD:238907 59/130 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.