DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and ppil2

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_957285.2 Gene:ppil2 / 393966 ZFINID:ZDB-GENE-040426-1096 Length:524 Species:Danio rerio


Alignment Length:251 Identity:89/251 - (35%)
Similarity:145/251 - (57%) Gaps:20/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YIQEPPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPN 69
            |:::   .|.|.|.|..||:::||...:.|||..||::||.:|||..|.|||.::.|::|||||.
Zfish   275 YVKK---KGYVRLHTNKGDLNVELHCDKVPKAGENFIKLCKKGYYDGTVFHRSIRNFMIQGGDPT 336

  Fly    70 GDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKIT 134
            |.||||||.:|:||||||...|.:|.||::.|||||.:.|.||||.||.....|..|:::||::.
Zfish   337 GTGTGGESFWGKPFKDEFRPNLSHTGRGILSMANSGPNTNKSQFFITFRSCAYLDRKHSVFGRVV 401

  Fly   135 G--DTIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDDIVPRILSQPSTKSKKTKKERQGVK 197
            |  :|:..|..:|..  ...::|....:|:||.|..:|:::...:|.::...:::|.::||  .:
Zfish   402 GGLETLSAMENVESD--PKTDKPKSEIKILSTSVFVDPYEEADAQIAAEREKEAQKVEEER--AQ 462

  Fly   198 NFGLLSFGEEAEGDEEE------TNVYVKQNAGKAKSLHDVTDDPKLSKEPIRVPK 247
            ...|::   :|:.:|:.      ...|:..:|  .|..|...:.|..|:.|.:.||
Zfish   463 TSALVN---KAKTEEKPKAFRPGVGKYINMSA--TKHSHPDAEKPSTSEAPAKKPK 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 72/171 (42%)
ppil2NP_957285.2 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 71/160 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.