DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CG2852

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster


Alignment Length:172 Identity:69/172 - (40%)
Similarity:102/172 - (59%) Gaps:21/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPTSGKVLLKTTVGD-----IDIELWARECPKACRNFVQLCL----EGYYKNTEFHRLVKGFIVQ 64
            |..:.||....|:|.     |:|.|:.:..||...||.:|.|    || ||.::|||::|.|::|
  Fly    25 PKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG-YKGSKFHRIIKDFMIQ 88

  Fly    65 GGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNT 128
            ||| ..||||||.||||:.|:|| :.:|::...|.:.|||:|||.||||||.|...|..|..::.
  Fly    89 GGDFTKGDGTGGRSIYGERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHV 152

  Fly   129 LFGKI-TGDTIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSN 169
            :|||| :|..:  :.::|:...|.::||      |...|::|
  Fly   153 VFGKILSGMNV--VRQIENSATDARDRP------VKDVVIAN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 69/172 (40%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 68/167 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.