DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and cyp33

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:147 Identity:57/147 - (38%)
Similarity:78/147 - (53%) Gaps:22/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EPPTSGKVLLK-----------------TTVGDIDIELWARECPKACRNFVQLCL--EGY-YKNT 52
            |.|::|..:::                 ...|.|.:.|.|...||...||.|||.  :|| ||..
  Fly   122 ETPSTGPAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGC 186

  Fly    53 EFHRLVKGFIVQGGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFT 116
            .|||::..|:.|||| .|.:||||:||||:.|.|| :..|::...|.:.|||||.:.||||||..
  Fly   187 SFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDE-NFNLKHNSFGTLSMANSGANTNGSQFFIC 250

  Fly   117 FAPTPELQNKNTLFGKI 133
            ...|..|.||:.:||.:
  Fly   251 TTKTDWLDNKHVVFGHV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 57/147 (39%)
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 54/130 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447233
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.