DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CG7747

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:277 Identity:101/277 - (36%)
Similarity:149/277 - (53%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGES 77
            |.|.|.|.:|.:::||:..:.|:||.||::.|..|||.|..|||.::.||||||||.|.|:||||
  Fly   280 GYVRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGES 344

  Fly    78 IYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIYN 140
            |:|:.|:|||...|.:|.||::.|||||.:.||||||.|:.....|..|:|:|||:.|  ||:..
  Fly   345 IWGKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQK 409

  Fly   141 MLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDDIVPRILSQPSTKSKKTKKERQGVKNFGLLSFG 205
            |..:|   ||:::||:....|.|::|..|||           :..:::..|||:           
  Fly   410 MENIE---VDNKDRPIEDIIIESSQVFVNPF-----------AEAAEQLAKERE----------- 449

  Fly   206 EEAEGDEEETNVYVKQNAGKAKSLHDVTDDPKLSKEPIRVPKVEKADIEEHLSDDCPEDSVKDKP 270
            |||.|.||    .||:.           :..|..|||:   ||.:..:.::|.    ..:|..||
  Fly   450 EEAAGKEE----IVKKE-----------EQQKRMKEPL---KVYREGVGKYLK----LQTVAKKP 492

  Fly   271 STASSDLIKMKLSKRSK 287
               .:.|...:.:|:.|
  Fly   493 ---EAPLTSAQAAKKKK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 77/166 (46%)
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 76/171 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447190
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45625
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.