DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CG17266

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:137 Identity:58/137 - (42%)
Similarity:78/137 - (56%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TTVGDIDIELWARECPKACRNFVQLCLEGY--------YKNTEFHRLVKGFIVQGGD-PNGDGTG 74
            |.:|.:..||:|...|:...||.|.|...|        ||...|||::|.|::|||| ..|||||
  Fly    28 TEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTG 92

  Fly    75 GESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITGDTIY 139
            ..||||..|.|| :..|::...||:.||||||:.||.|||.|.|....|..|:.:||::. |.:.
  Fly    93 VTSIYGNTFGDE-NFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVL-DGLL 155

  Fly   140 NMLKLED 146
            .|.|:|:
  Fly   156 IMRKIEN 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 58/137 (42%)
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 58/137 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447248
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.