DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and ppiaa

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_997923.3 Gene:ppiaa / 336612 ZFINID:ZDB-GENE-030131-8556 Length:164 Species:Danio rerio


Alignment Length:117 Identity:55/117 - (47%)
Similarity:74/117 - (63%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQGGD-PNGDGTGGESIYGQ 81
            ||.:.:||.|...|:...||.|||.  .|| ||.:.|||::.||:.|||| .|.:||||:||||.
Zfish    17 VGRVVMELRADVVPRTAENFRQLCTGQPGYGYKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGN 81

  Fly    82 PFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI 133
            .|.|| :..|::|..|.:.|||:|.:.||||||...|.|..|..|:.:||::
Zfish    82 KFADE-NFNLKHTGAGCLSMANAGPNTNGSQFFICTALTSWLDGKHVVFGQV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 55/117 (47%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
ppiaaNP_997923.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.