DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and ninaA

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster


Alignment Length:160 Identity:67/160 - (41%)
Similarity:84/160 - (52%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KTTVGDIDIELWARECPKACRNFVQLCLEGY----YKNTEFHRLVKGFIVQGGD-PNGDGTGGES 77
            |..||.|...|:.:..||...||..:||.|.    |..:.|||:|..|:||||| .||||||..|
  Fly    37 KKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSIS 101

  Fly    78 IYGQPFKDEFHS-RLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIY 139
            |||..|.||..: .:.:.|.|.:||||.|.|.||.||:.|......|..|:|:|||:..  ||||
  Fly   102 IYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIY 166

  Fly   140 NMLKLEDGIVDHQERPMHAHRIVSTEVLSN 169
               .:||...|..:.|      |...|:||
  Fly   167 ---AIEDVKTDTDDFP------VEPVVISN 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 67/160 (42%)
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 67/160 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.