DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and Ppil3

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_783638.1 Gene:Ppil3 / 301432 RGDID:631415 Length:161 Species:Rattus norvegicus


Alignment Length:159 Identity:70/159 - (44%)
Similarity:96/159 - (60%) Gaps:4/159 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGESIY 79
            |.|.|.||||.||::....||.|.||:.||...||....|||.:|||:||.|||.|.|.||.||:
  Rat     3 VTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIW 67

  Fly    80 GQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITG--DTIYNML 142
            |:.|:||:...|::..||:|.|||:|.:.||||||.|:...|.|..|.|:|||:..  :|:..:.
  Rat    68 GKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELE 132

  Fly   143 KLEDGIVDHQERPMHAHRIVSTEVLSNPF 171
            ||.  :.:...||::...|....:.:|||
  Rat   133 KLP--VNEKTYRPLNDVHIKDITIHANPF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 70/159 (44%)
Ppil3NP_783638.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 67/152 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.