DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and Ppie

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001382655.1 Gene:Ppie / 298508 RGDID:1311411 Length:301 Species:Rattus norvegicus


Alignment Length:174 Identity:61/174 - (35%)
Similarity:87/174 - (50%) Gaps:40/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQGGD-PNGDGTGGESIYGQP 82
            |.|.:.|.:...|....||..||.  :|: :|.:.|||::..|:.|||| .|.:||||:||||:.
  Rat   154 GRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKK 218

  Fly    83 FKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITGDTIYNMLKLEDG 147
            |.|| :..|::|..||:.|||||.:.||||||.|...|..|..|:.:||:||           ||
  Rat   219 FDDE-NFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEIT-----------DG 271

  Fly   148 IVDHQERPMHAHRIVSTEVLSNPFDDIVPRILSQPSTKSKKTKK 191
            :                        |::.:|.:|.|...|..:|
  Rat   272 L------------------------DVLRQIEAQGSKDGKPKQK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 56/159 (35%)
PpieNP_001382655.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 140..298 CDD:238907 61/174 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.