DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and Ppif

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_758443.1 Gene:Ppif / 282819 RGDID:628670 Length:206 Species:Rattus norvegicus


Alignment Length:216 Identity:64/216 - (29%)
Similarity:92/216 - (42%) Gaps:70/216 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PTSGKVLLKTT------------------------------VGDIDIELWARECPKACRNFVQLC 44
            |.|..:||.||                              :|.:.:||.|...||...||..||
  Rat    17 PRSAPLLLSTTRTCSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALC 81

  Fly    45 L--EGY-YKNTEFHRLVKGFIVQGGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSG 105
            .  :|: ||.:.|||::..|:.|.|| .|.:||||:||||..|.|| :..|::...|::.|||:|
  Rat    82 TGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDE-NFTLKHVGPGVLSMANAG 145

  Fly   106 KDDNGSQFFFTFAPTPELQNKNTLFGKITGDTIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSNP 170
            .:.||||||.....|..|..|:.:||.:           ::|:                      
  Rat   146 PNTNGSQFFICTIKTDWLDGKHVVFGHV-----------KEGM---------------------- 177

  Fly   171 FDDIVPRILSQPSTKSKKTKK 191
              |:|.:|.|..|...|.:||
  Rat   178 --DVVKKIESFGSKSGKTSKK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 58/201 (29%)
PpifNP_758443.1 cyclophilin_ABH_like 45..203 CDD:238907 58/188 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.