DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CG32236

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster


Alignment Length:253 Identity:50/253 - (19%)
Similarity:91/253 - (35%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MANSGKDDNGSQFFFTFAPTPE--------------LQNKN-------------TLFGKI---TG 135
            |.|.|.   |...||...||..              :|||:             ..|.||   .|
  Fly     1 MNNRGV---GFSEFFVKTPTSRSIQLRAKKVAKELVMQNKDVRDKILKNKVLTYAQFRKIMKSAG 62

  Fly   136 D-------TIYNMLKLEDGIVDHQERP----------MHAHRIVSTEVLSNPFDDIVPRILSQPS 183
            :       |..:|:::....:||:...          .|| |:::...|:..|            
  Fly    63 NVTDLNPITYKSMIEIRQSQIDHRRLKSIKSAGDSLGFHA-RLLNRSQLAGEF------------ 114

  Fly   184 TKSKKTKKERQGVKNFGLLSFGEEAEGDEEETNVY---VKQNAGKAKSLHDVTDDPKLSKE---- 241
              ::|.:..|:.::..|.::.....:|..:..|.:   ::.|..|.:.|.|     :||:|    
  Fly   115 --NQKQEIFRKNMELLGRINKTNRLKGGVDSFNRHFPALQSNRNKIRELAD-----RLSQENRQL 172

  Fly   242 PIRVPKVEKADIEEHLSDDCPEDSVKDKPS--TASSDLIKMKLSKRSKSGADKKVQPV 297
            ..|:.:| |:.::.|.....|...::.|.|  |.|:.|..|...:..|..|...::|:
  Fly   173 GCRLSQV-KSKVDSHNPWVPPVKPLEQKASDETVSTFLPYMPSPRLGKRSAQILLRPI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 24/123 (20%)
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 19/111 (17%)
cyclophilin 227..385 CDD:294131 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.