DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10907 and Ranbp2

DIOPT Version :9

Sequence 1:	NP_648508.1	Gene:	CG10907 / 39331	FlyBaseID:	FBgn0036207	Length:	502	Species:	Drosophila melanogaster
Sequence 2:	NP_035370.2	Gene:	Ranbp2 / 19386	MGIID:	894323	Length:	3053	Species:	Mus musculus

Alignment Length:	129	Identity:	54/129 - (41%)
Similarity:	78/129 - (60%)	Gaps:	6/129 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 VGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQGGD-PNGDGTGGESIYGQ 81
            :|.|.:||::...|:...||..||.  :|: :||:.|||:|..||.|||| ...:||||:||||.
Mouse  2906 LGRIIMELFSNIVPQTAENFRALCTGEKGFGFKNSIFHRVVPDFICQGGDITKYNGTGGQSIYGD 2970

  Fly    82 PFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITGDTIYNMLKLE 145
            .|.|| :..|::|..||:.|||.|::.|.||||.|......|..|:.:||.:. |.:..:.|:|
Mouse  2971 KFDDE-NFDLKHTGPGLLSMANYGQNTNSSQFFITLKKAEHLDFKHVVFGFVK-DGMDTVRKIE 3032

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10907	NP_648508.1	cyclophilin_CeCYP16-like	8..178	CDD:238906	54/129 (42%)
Ranbp2	NP_035370.2	TPR 1	26..59
		TPR_11	59..126	CDD:290150
		TPR repeat	59..89	CDD:276809
		TPR 2	60..93
		TPR_1	60..92	CDD:278916
		TPR 3	94..128
		TPR 4	165..201
		TPR 5	288..319
		TPR 6	583..616
		TPR 7	648..681
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	773..802
		RCR	<839..925	CDD:304939
		20 X 2 AA repeats of F-G. /evidence=ECO:0000305	1000..3035		54/129 (42%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1147..1171
		RanBD1_RanBP2-like	1180..1296	CDD:270203
		zf-RanBP	1345..1374	CDD:279035
		RanBP2-type Zn finger	1350..1369	CDD:275375
		zf-RanBP	1410..1438	CDD:279035
		RanBP2-type Zn finger	1414..1433	CDD:275375
		zf-RanBP	1469..1498	CDD:279035
		RanBP2-type Zn finger	1473..1492	CDD:275375
		zf-RanBP	1499..1524	CDD:279035
		RanBP2-type Zn finger	1502..1521	CDD:275375
		zf-RanBP	1558..1587	CDD:279035
		RanBP2-type Zn finger	1562..1581	CDD:275375
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1587..1609
		zf-RanBP	1617..1645	CDD:279035
		RanBP2-type Zn finger	1621..1640	CDD:275375
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1648..1675
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1744..1772
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1819..1846
		RanBD2_RanBP2-like	1864..1980	CDD:269998
		Interaction with BICD2. /evidence=ECO:0000250\|UniProtKB:P49792	1984..2124
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2030..2060
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2111..2144
		RanBD3_RanBP2-like	2161..2277	CDD:270204
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2316..2348
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2394..2430
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2443..2463
		IR1-M	2468..2529	CDD:288995
		Interaction with sumoylated RANGAP1. /evidence=ECO:0000250	2468..2472
		2 X 50 AA approximate repeats	2470..2596
		Required for E3 SUMO-ligase activity. /evidence=ECO:0000250	2470..2545
		Interaction with UBE2I. /evidence=ECO:0000250	2470..2522
		Interaction with SUMO1. /evidence=ECO:0000250	2523..2596
		IR1-M	2544..2602	CDD:288995
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2598..2666
		RanBD4_RanBP2-like	2754..2870	CDD:269999
		cyclophilin_ABH_like	2893..3051	CDD:238907	54/129 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0652
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900