DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and cyn-2

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_499828.1 Gene:cyn-2 / 176807 WormBaseID:WBGene00000878 Length:172 Species:Caenorhabditis elegans


Alignment Length:136 Identity:53/136 - (38%)
Similarity:78/136 - (57%) Gaps:17/136 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVLLKTTVGD-----IDIELWARECPKACRNFVQLCL----EG------YYKNTEFHRLVKGFIV 63
            ||....|:|.     |.:||:....||...||..||.    :|      ::|.::|||::..|::
 Worm     5 KVFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIPEFMI 69

  Fly    64 QGGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKN 127
            |||| ..|:|||||||:|:.|.|| :.:.::|..|::.|||.|.:.||||||.....|..|..|:
 Worm    70 QGGDFTEGNGTGGESIHGEKFDDE-NFKEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLDGKH 133

  Fly   128 TLFGKI 133
            .:|||:
 Worm   134 VVFGKV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 53/136 (39%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
cyn-2NP_499828.1 cyclophilin_ABH_like 5..169 CDD:238907 53/136 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.