DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and cyn-4

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_496337.1 Gene:cyn-4 / 174674 WormBaseID:WBGene00000880 Length:523 Species:Caenorhabditis elegans


Alignment Length:252 Identity:92/252 - (36%)
Similarity:131/252 - (51%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IQEPPTSGK-------------------VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKN 51
            :..|.||.|                   |.|.|..|.:::||:|.:.||||.||:..|..|||.|
 Worm   254 VMAPVTSNKAAVLDNDTVRYSRVKKNAFVRLVTNFGPLNLELFAPKVPKACENFITHCSNGYYNN 318

  Fly    52 TEFHRLVKGFIVQGGDPNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFT 116
            |:||||:|.|::|||||.|.|.|||||:.:||.|||.|...:..||::.|||.|.:.||||||.|
 Worm   319 TKFHRLIKNFMLQGGDPTGTGHGGESIWDKPFSDEFISGFSHDARGVLSMANKGSNTNGSQFFIT 383

  Fly   117 FAPTPELQNKNTLFGKITG--DTIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDDIVPRIL 179
            |.|...|..|:|:||::.|  ||:..:.|||  ..:..:.||.:..|:..||..:||::....:.
 Worm   384 FRPCKYLDRKHTIFGRLVGGQDTLTTIEKLE--TEEGTDVPMVSVVIMRAEVFVDPFEEAEKEVQ 446

  Fly   180 SQPSTKSKKTKKERQGVKNFGLLSFGEEAEGDEEETNVYVKQNAGKAKSLHDVTDDP 236
            ::.:...|||.|:...:.|........:.|........|:|..|...|....:.|.|
 Worm   447 AERAEILKKTSKDAASLANKKAKETATKPEAVGTGVGKYMKSAAAVNKRQGKMEDVP 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 80/190 (42%)
cyn-4NP_496337.1 Ubox 45..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 76/160 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.