DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and LOC1277821

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_061513413.1 Gene:LOC1277821 / 1277821 VectorBaseID:AGAMI1_014506 Length:714 Species:Anopheles gambiae


Alignment Length:156 Identity:34/156 - (21%)
Similarity:62/156 - (39%) Gaps:41/156 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 KILKASGRPQANWVTRWALKRSICKSASPQLIDYCLKHFGGVLVDDGSRVVSSRCNPGSNDFEYR 421
            |:.||...|.:..:....:.||:.:.:..:|       |..:    ....:.||..|.|:. .|.
Mosquito   135 KLQKAPTPPISEEIPAQKMTRSLSQRSKRRL-------FFSI----AGPTICSRKPPMSHK-RYT 187

  Fly   422 LESVNNVHRLSNQ----DVNNASVEHVKQDLRYLYETLLHPQTMAEFRS----RATREKMIDAAT 478
            ::..:.|.:..||    |:..:|||..:     :.|.:|..|....::|    |.:|||  |.|.
Mosquito   188 IDEASEVMKSFNQQKYVDLRESSVESDR-----MLEEMLEKQKQLVWKSVRIARISREK--DRAE 245

  Fly   479 KI--------------LDCKHFIKDY 490
            |.              :.|:|.::|:
Mosquito   246 KTETLMEEVRFFWSIEMQCRHAVEDW 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906
PTZ00121 <279..>426 CDD:173412 13/68 (19%)
CWC27_CTD 390..451 CDD:412084 13/64 (20%)
LOC1277821XP_061513413.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.