DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and ppwd1

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_002934239.3 Gene:ppwd1 / 100488042 XenbaseID:XB-GENE-1001509 Length:640 Species:Xenopus tropicalis


Alignment Length:167 Identity:69/167 - (41%)
Similarity:96/167 - (57%) Gaps:23/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGE 76
            |...::.|::|||.::|:..||||...||......|||....|||::|||::|.|||.|.|.|||
 Frog   485 SDSAIIHTSMGDIHVKLFPVECPKTVENFCVHSRNGYYNRHMFHRVIKGFMIQTGDPTGTGMGGE 549

  Fly    77 SIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKIT-GDTIYN 140
            ||:|..|:||||:.||:.|...:.|||:|...||||||.|..|||.|.||:|:||::| |..:  
 Frog   550 SIWGGEFEDEFHATLRHDRPYTLSMANAGPSTNGSQFFLTVVPTPWLDNKHTVFGRVTKGMEV-- 612

  Fly   141 MLKLEDGIVDHQERPMHAHRIVSTEV---LSNPFDDI 174
                             ..||.:::|   ...|::||
 Frog   613 -----------------VQRICNSKVNPKTDKPYEDI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 69/167 (41%)
ppwd1XP_002934239.3 WD40 83..312 CDD:421866
WD40 repeat 88..125 CDD:293791
WD40 repeat 131..169 CDD:293791
WD40 repeat 177..213 CDD:293791
WD40 repeat 221..266 CDD:293791
cyclophilin_WD40 489..637 CDD:238908 68/163 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.