DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K68D and CG30184

DIOPT Version :9

Sequence 1:NP_001163420.1 Gene:Pi3K68D / 39329 FlyBaseID:FBgn0015278 Length:1876 Species:Drosophila melanogaster
Sequence 2:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster


Alignment Length:77 Identity:18/77 - (23%)
Similarity:31/77 - (40%) Gaps:16/77 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1204 YDESQVTQVRYYRRNKMMLRALMAICG-EKMLQRFMYQHRMCQKLTTIA---------------E 1252
            :..|:..|..:.:|:|..|:......| |..|.||.:..|:..::.|.|               |
  Fly   139 HSRSRANQKMHPQRSKRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHSGRKRQVSSSE 203

  Fly  1253 SVKEAKESMRQK 1264
            |..:|||...::
  Fly   204 SDSDAKEREEER 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K68DNP_001163420.1 EIN3 <58..392 CDD:296674
PI3K_rbd 561..669 CDD:197540
C2A_PI3K_class_II 844..1021 CDD:175979
PI3Ka_II 1038..1202 CDD:238441
PI3Kc_II 1235..1583 CDD:270710 10/45 (22%)
PX_PI3K_C2_68D 1611..1721 CDD:132794
C2B_PI3K_class_II 1751..1871 CDD:176027
CG30184NP_726341.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.