powered by:
Protein Alignment Tim13 and TIM13
DIOPT Version :9
Sequence 1: | NP_648505.1 |
Gene: | Tim13 / 39327 |
FlyBaseID: | FBgn0036204 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011697.3 |
Gene: | TIM13 / 853093 |
SGDID: | S000003413 |
Length: | 105 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 69 |
Identity: | 28/69 - (40%) |
Similarity: | 49/69 - (71%) |
Gaps: | 3/69 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 ELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSRTYG 74
||.||:.|::|:|||.|:::|::|.||:||:..| ..:....||.||:.::|.:||::|:.|.
Yeast 32 ELKNQIAQELAVANATELVNKISENCFEKCLTSP---YATRNDACIDQCLAKYMRSWNVISKAYI 93
Fly 75 NRLQ 78
:|:|
Yeast 94 SRIQ 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157346507 |
Domainoid |
1 |
1.000 |
63 |
1.000 |
Domainoid score |
I2464 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1733 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
69 |
1.000 |
Inparanoid score |
I1701 |
Isobase |
1 |
0.950 |
- |
0.928771 |
Normalized mean entropy |
S700 |
OMA |
1 |
1.010 |
- |
- |
|
QHG59611 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003493 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm46773 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103836 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR19338 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1516 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X2854 |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
15 | 14.740 |
|
Return to query results.
Submit another query.