DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and TIM13

DIOPT Version :9

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_011697.3 Gene:TIM13 / 853093 SGDID:S000003413 Length:105 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:28/69 - (40%)
Similarity:49/69 - (71%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSRTYG 74
            ||.||:.|::|:|||.|:::|::|.||:||:..|   ..:....||.||:.::|.:||::|:.|.
Yeast    32 ELKNQIAQELAVANATELVNKISENCFEKCLTSP---YATRNDACIDQCLAKYMRSWNVISKAYI 93

  Fly    75 NRLQ 78
            :|:|
Yeast    94 SRIQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..73 CDD:281019 23/59 (39%)
TIM13NP_011697.3 zf-Tim10_DDP 35..92 CDD:397210 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346507
Domainoid 1 1.000 63 1.000 Domainoid score I2464
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1701
Isobase 1 0.950 - 0.928771 Normalized mean entropy S700
OMA 1 1.010 - - QHG59611
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm46773
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - O PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.