DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and TIM13

DIOPT Version :9

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_564780.1 Gene:TIM13 / 842453 AraportID:AT1G61570 Length:87 Species:Arabidopsis thaliana


Alignment Length:62 Identity:28/62 - (45%)
Similarity:44/62 - (70%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSRT 72
            :|..||.|:|.|.|:|::..:..|||.||:.|||.||..:|..|||:|::|:|:|..::||:
plant    21 MMESVKTQLAQAYAEELIETLRTKCFDKCVTKPGSSLGGSESSCISRCVERYMEATAIISRS 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..73 CDD:281019 27/60 (45%)
TIM13NP_564780.1 zf-Tim10_DDP 25..83 CDD:397210 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3511
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2458
OMA 1 1.010 - - QHG59611
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm3168
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - O PTHR19338
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2854
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.