DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and TIM8

DIOPT Version :10

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_199894.1 Gene:TIM8 / 835153 AraportID:AT5G50810 Length:77 Species:Arabidopsis thaliana


Alignment Length:68 Identity:23/68 - (33%)
Similarity:38/68 - (55%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELMNQVKQQIALANAQEMLSKMTEKCFKKCI-QKPGKSLDSTEQRCISQCMDRFMDAWNLVSRTY 73
            ||:..:.|:...|...||:||||..|:.||| ..||....|:|..|::.|..|:||...::.:.:
plant    10 ELLQFLAQEKERAMVNEMVSKMTSVCWDKCITSAPGSKFSSSESSCLTHCAQRYMDMSMIIMKRF 74

  Fly    74 GNR 76
            .::
plant    75 NSQ 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..75 CDD:460764 21/62 (34%)
TIM8NP_199894.1 zf-Tim10_DDP 13..76 CDD:460764 21/62 (34%)

Return to query results.
Submit another query.