powered by:
Protein Alignment Tim13 and CG42302
DIOPT Version :9
Sequence 1: | NP_648505.1 |
Gene: | Tim13 / 39327 |
FlyBaseID: | FBgn0036204 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097022.2 |
Gene: | CG42302 / 7354435 |
FlyBaseID: | FBgn0259198 |
Length: | 121 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 34/70 - (48%) |
Similarity: | 47/70 - (67%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 MNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSRTYGNR 76
:.:::|||.|||.||::.|||.:||..||..|...|.|||:.|::.|||||||:..:||..|..|
Fly 8 LERIRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDCLANCMDRFMDSVQVVSSQYFRR 72
Fly 77 LQREQ 81
.:|.|
Fly 73 RRRHQ 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45470266 |
Domainoid |
1 |
1.000 |
63 |
1.000 |
Domainoid score |
I2464 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1733 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
69 |
1.000 |
Inparanoid score |
I1701 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1566384at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003493 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm3168 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR19338 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.900 |
|
Return to query results.
Submit another query.