DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and CG42302

DIOPT Version :9

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001097022.2 Gene:CG42302 / 7354435 FlyBaseID:FBgn0259198 Length:121 Species:Drosophila melanogaster


Alignment Length:70 Identity:34/70 - (48%)
Similarity:47/70 - (67%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSRTYGNR 76
            :.:::|||.|||.||::.|||.:||..||..|...|.|||:.|::.|||||||:..:||..|..|
  Fly     8 LERIRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDCLANCMDRFMDSVQVVSSQYFRR 72

  Fly    77 LQREQ 81
            .:|.|
  Fly    73 RRRHQ 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..73 CDD:281019 30/59 (51%)
CG42302NP_001097022.2 zf-Tim10_DDP 11..69 CDD:281019 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470266
Domainoid 1 1.000 63 1.000 Domainoid score I2464
eggNOG 1 0.900 - - E1_KOG1733
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1701
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566384at2759
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm3168
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19338
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.