DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and CG42302

DIOPT Version :10

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001097022.2 Gene:CG42302 / 7354435 FlyBaseID:FBgn0259198 Length:121 Species:Drosophila melanogaster


Alignment Length:40 Identity:10/40 - (25%)
Similarity:16/40 - (40%) Gaps:3/40 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SNAPPPFLSKTYDMVDDHNTDSI---VSWSANNNSFIVWK 68
            :||...:|.:......|....|:   :....|.|:.|.||
  Fly   155 TNASDDYLREVIRKNFDFEISSVARFIMMPYNENNTIQWK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..75 CDD:460764 10/40 (25%)
CG42302NP_001097022.2 zf-Tim10_DDP 11..69 CDD:460764
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.