DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and timm13

DIOPT Version :9

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001002465.1 Gene:timm13 / 436738 ZFINID:ZDB-GENE-040718-167 Length:95 Species:Danio rerio


Alignment Length:80 Identity:51/80 - (63%)
Similarity:67/80 - (83%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAANMEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAW 66
            ::..|:.|.:|.|||.|||:|||||:|.:||:|||||||.|||.:||::||:||:.||||:||||
Zfish    13 SSGKMDTGTIMEQVKVQIAVANAQELLQRMTDKCFKKCIGKPGSTLDNSEQKCIAMCMDRYMDAW 77

  Fly    67 NLVSRTYGNRLQREQ 81
            |.|||.|.:|||||:
Zfish    78 NTVSRAYNSRLQRER 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..73 CDD:281019 42/59 (71%)
timm13NP_001002465.1 zf-Tim10_DDP 24..84 CDD:281019 42/59 (71%)
Twin CX3C motif 46..69 15/22 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595919
Domainoid 1 1.000 104 1.000 Domainoid score I6658
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40846
Inparanoid 1 1.050 121 1.000 Inparanoid score I4731
OMA 1 1.010 - - QHG59611
OrthoDB 1 1.010 - - D1566384at2759
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm26152
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - O PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.