DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and Timm13

DIOPT Version :10

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_038923.1 Gene:Timm13 / 30055 MGIID:1353432 Length:95 Species:Mus musculus


Alignment Length:76 Identity:50/76 - (65%)
Similarity:65/76 - (85%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVS 70
            ::.|.:|.|||.|||:|||||:|.:||:|||:|||.|||.|||::||:||:.||||:|||||.||
Mouse    17 LDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVS 81

  Fly    71 RTYGNRLQREQ 81
            |.|.:|||||:
Mouse    82 RAYNSRLQRER 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..75 CDD:460764 43/61 (70%)
Timm13NP_038923.1 zf-Tim10_DDP 24..86 CDD:460764 43/61 (70%)
Twin CX3C motif 46..69 15/22 (68%)

Return to query results.
Submit another query.