DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and tim13

DIOPT Version :9

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_594597.1 Gene:tim13 / 2542145 PomBaseID:SPAC17C9.09c Length:95 Species:Schizosaccharomyces pombe


Alignment Length:75 Identity:40/75 - (53%)
Similarity:59/75 - (78%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSR 71
            :|...|.|::|::|:|.|.|::||:.|.||.|||.:||.:.|..|:.|:|:||:|:|||||:|||
pombe    17 KKSIFMKQIRQELAVAQAGELISKINENCFDKCIPEPGSTFDPNEKSCVSKCMERYMDAWNIVSR 81

  Fly    72 TYGNRLQREQ 81
            ||.:|:||||
pombe    82 TYISRMQREQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..73 CDD:281019 31/59 (53%)
tim13NP_594597.1 zf-Tim10_DDP 23..83 CDD:281019 31/59 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2166
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I1676
OMA 1 1.010 - - QHG59611
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm47223
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - O PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.