DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tim13 and Timm13

DIOPT Version :9

Sequence 1:	NP_648505.1	Gene:	Tim13 / 39327	FlyBaseID:	FBgn0036204	Length:	92	Species:	Drosophila melanogaster
Sequence 2:	NP_665724.1	Gene:	Timm13 / 252928	RGDID:	628845	Length:	95	Species:	Rattus norvegicus

Alignment Length:	76	Identity:	50/76 - (65%)
Similarity:	65/76 - (85%)	Gaps:	0/76 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 MEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVS 70
            ::.|.:|.|||.|||:|||||:|.:||:|||:|||.|||.|||::||:||:.||||:|||||.||
  Rat    17 LDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVS 81

  Fly    71 RTYGNRLQREQ 81
            |.|.:|||||:
  Rat    82 RAYNSRLQRER 92

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tim13	NP_648505.1	zf-Tim10_DDP	13..73	CDD:281019	42/59 (71%)
Timm13	NP_665724.1	zf-Tim10_DDP	24..84	CDD:397210	42/59 (71%)
Timm13	NP_665724.1	Twin CX3C motif	46..69		15/22 (68%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166353770
Domainoid	1	1.000	103	1.000	Domainoid score	I6620
eggNOG	1	0.900	-	-		E1_KOG1733
Hieranoid	1	1.000	-	-
Homologene	1	1.000	-	-		H40846
Inparanoid	1	1.050	120	1.000	Inparanoid score	I4678
OMA	1	1.010	-	-		QHG59611
OrthoDB	1	1.010	-	-		D1566384at2759
OrthoFinder	1	1.000	-	-		FOG0003493
OrthoInspector	1	1.000	-	-		otm45343
orthoMCL	1	0.900	-	-		OOG6_103836
Panther	1	1.100	-	-	O	PTHR19338
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X2854
SwiftOrtho	1	1.000	-	-
TreeFam	1	0.960	-	-
	16	15.770