DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and ddp-1

DIOPT Version :10

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_497467.1 Gene:ddp-1 / 175331 WormBaseID:WBGene00000941 Length:83 Species:Caenorhabditis elegans


Alignment Length:71 Identity:17/71 - (23%)
Similarity:34/71 - (47%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAANMEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCI--QKPGKSLDSTEQRCISQCMDRFM 63
            |.:|:.:....:.|::.:.......|.:..:|.:|:..|.  .:|...:|...|.||..|::|.:
 Worm     1 MDSADPQLNRFLQQLQAETQRQKFTEQVHTLTGRCWDVCFADYRPPSKMDGKTQTCIQNCVNRMI 65

  Fly    64 DAWNLV 69
            ||.|.:
 Worm    66 DASNFM 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..75 CDD:460764 15/59 (25%)
ddp-1NP_497467.1 zf-Tim10_DDP 13..77 CDD:460764 15/59 (25%)

Return to query results.
Submit another query.