DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim13 and tin-13

DIOPT Version :9

Sequence 1:NP_648505.1 Gene:Tim13 / 39327 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_492370.1 Gene:tin-13 / 172686 WormBaseID:WBGene00006574 Length:108 Species:Caenorhabditis elegans


Alignment Length:74 Identity:39/74 - (52%)
Similarity:57/74 - (77%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSR 71
            ::.::::.||||.||||||.:::.::|||..|||..||.||.|.|::|:.:||||||::|||||:
 Worm    17 QQEQVISGVKQQAALANAQNLVTDISEKCTNKCITAPGSSLASGEKQCLQRCMDRFMESWNLVSQ 81

  Fly    72 TYGNRLQRE 80
            |...|||.|
 Worm    82 TLQKRLQEE 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim13NP_648505.1 zf-Tim10_DDP 13..73 CDD:281019 34/59 (58%)
tin-13NP_492370.1 zf-Tim10_DDP 25..83 CDD:397210 34/57 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167244
Domainoid 1 1.000 81 1.000 Domainoid score I5471
eggNOG 1 0.900 - - E1_KOG1733
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3703
Isobase 1 0.950 - 0.928771 Normalized mean entropy S700
OMA 1 1.010 - - QHG59611
OrthoDB 1 1.010 - - D1566384at2759
OrthoFinder 1 1.000 - - FOG0003493
OrthoInspector 1 1.000 - - otm14248
orthoMCL 1 0.900 - - OOG6_103836
Panther 1 1.100 - - O PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1516
SonicParanoid 1 1.000 - - X2854
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.