DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG13837

DIOPT Version :10

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster


Alignment Length:220 Identity:44/220 - (20%)
Similarity:84/220 - (38%) Gaps:46/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1303 TTPGHQE---DRTDCSNMPN-GIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSL 1363
            |..||:.   :..:|::.|. |:::....:|:||..|....:....|....::|.|.:.|....|
  Fly    13 TLLGHRSSALEFEECASAPQLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERCLDRKL 77

  Fly  1364 VDCPLDEAPENVT-------KKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQCPQ 1421
            |....|  |..:|       |||:. ::.|...:||   .:.:...|..:.||..|..:.:.|..
  Fly    78 VSRCRD--PVGITTKSPSMVKKPAQ-KAEPLAITLR---LLPNAGPCYPYMVCYEGAGLAKACTP 136

  Fly  1422 GLHFDIKSNFCNYPILVQCSLEESQADAHGALLAEGVPDCTKVKEDTRFGDVKQHNK---YYVCL 1483
            . |            ||.|:..:::         |.:.:|    ::..:|.:.....   :|.|.
  Fly   137 A-H------------LVSCNRMQTR---------ENIINC----QEGVYGFMPHPRNCAYFYYCS 175

  Fly  1484 KGKAVLHYCSPGNWFDLRSQKCIDQ 1508
            .|..::|.|.....:....:.|:.|
  Fly   176 SGSKLVHRCHLNYTWHYERRSCVQQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
dermokine <1084..>1257 CDD:455732
CBM_14 1314..1366 CDD:426342 13/52 (25%)
CBM_14 1388..1440 CDD:426342 10/51 (20%)
ChtBD2 1459..1505 CDD:214696 7/48 (15%)
CG13837NP_651113.1 CBM_14 36..81 CDD:426342 10/44 (23%)
CBM_14 154..203 CDD:426342 9/51 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.