DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG6933

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster


Alignment Length:342 Identity:82/342 - (23%)
Similarity:119/342 - (34%) Gaps:89/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1039 STTQESSSSTEGPLSTESSTEASNESSSTESSQ-DSTTQES-SSSTEGPLSTESSTEVTQEPSPT 1101
            :||..|:|:.|...:.:|....:|..:.||.:. |.|.|.| .....|.:.:.|||:....|:  
  Fly    91 NTTVCSTSAVETCSNVKSPMYVANPLNCTEYAYCDGTGQISYGDCGTGGVYSASSTKCIWGPA-- 153

  Fly  1102 ESLPNSSTQGTPCTTDNPSSLEPSPSTPGNDDDSGN-SGSENGNSSTSGSPCTTDNPSDPESSSS 1165
                        |..|.......|....|:.:..|| ....||..:           |:..||::
  Fly   154 ------------CPQDTICRFMLSNIFVGDPNQCGNYINCVNGYGT-----------SEKCSSTA 195

  Fly  1166 TPGNDDDSGNSGSENGNSSTSGSPCTTDNPSDPESSSSTPGNDDDSGNSGSES-GITSTTGAPYT 1229
            .|..:..:||..|.|        |||              |.|.:||||...: |.|:.|..   
  Fly   196 NPYYNKATGNCQSTN--------PCT--------------GEDSNSGNSDQFTVGQTNATAC--- 235

  Fly  1230 TDNPASQEPSPSAPENPGDSGNSSSESPPEGATPC-------TPNAPKKSTTSSYTAHPTPKYTT 1287
             |..|.:...|....  |:|.:....|  :|.| |       ..||     |..:...||     
  Fly   236 -DEEAFKAADPLTVN--GESVDYRYVS--DGVT-CYGYYYCAAVNA-----TGYWNQCPT----- 284

  Fly  1288 EGNKAETSTLKSPTGTTPGHQEDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNL-HF 1351
             |.:.......||......|..    |.|: |..|:.| :.|..|.:|.:|  |.|.||.|. ::
  Fly   285 -GTQFNAGKCVSPASFVCTHNR----CGNV-NNPFMAD-EGCKNYTICSSG--ITGSCPTNAPYY 340

  Fly  1352 DIKRKVC--NFPSLVDC 1366
            |....:|  ..|....|
  Fly   341 DEVNNICTTKIPDYAIC 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023 24/121 (20%)
CBM_14 1314..1366 CDD:279884 17/54 (31%)
CBM_14 1388..1440 CDD:279884
ChtBD2 1459..1505 CDD:214696
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.