DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG7017

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster


Alignment Length:204 Identity:53/204 - (25%)
Similarity:78/204 - (38%) Gaps:22/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1314 CSNMPNGIFLRDFQS--CNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDCPLDEAPENVT 1376
            |:|...|.|:.|..|  |..|.:|.:.|.|..:||..|.|....:.|.:.....||:.:     |
  Fly   103 CANETEGAFIVDPSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQ-----T 162

  Fly  1377 KKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQCPQGLHFDIKSNFCNYPILVQCS 1441
            ||.|     |.|:||.|...:.||..|.::|.|.:.....|.||....:|....:|.....|.|.
  Fly   163 KKTS-----PACRSLPNNTRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCY 222

  Fly  1442 LEESQADAHGALLAEGVPDCTKVKEDTRFGDVKQHNKYYVCLKGKAVLH-------YCSPGNWFD 1499
            ...:..:.......:......:|   ..|.|.:..:.||:|....|..|       .|..|.:||
  Fly   223 ESAALPEPENTFCLDSATGSARV---GYFADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFD 284

  Fly  1500 LRSQKCIDQ 1508
            .....|.|:
  Fly   285 FEKLSCRDR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 16/53 (30%)
CBM_14 1388..1440 CDD:279884 15/51 (29%)
ChtBD2 1459..1505 CDD:214696 12/52 (23%)
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 16/51 (31%)
ChtBD2 246..290 CDD:214696 11/43 (26%)
CBM_14 303..348 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.