DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG6996

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:225 Identity:60/225 - (26%)
Similarity:90/225 - (40%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1285 YTTEGNKAETSTLKSPTGTTPGHQEDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNL 1349
            |..|..|..:|:......:.|        |:.:|.| |..|..|||.||.|.:||...|.|...:
  Fly    66 YDRESQKCLSSSSIKCLSSDP--------CAALPTG-FAADPYSCNGYYYCKDGKGTHGVCNTGM 121

  Fly  1350 HFDIKRKVCNFPSLVDCPLDEAPENVTKKPSDTESTPD--CKSLRNGAYVRDPKSCSRFYVCANG 1412
            :|:...:.|                :...|...:..||  |..|.:|.:|:|..:|:.:.:|.:|
  Fly   122 NFNSGTQDC----------------IRDFPCSNKMDPDSYCNILPDGVFVKDTDNCNGYQLCWDG 170

  Fly  1413 RAIPRQCPQGLHFDIKSNFCNYPILVQCSLEESQADAHGALLAEGVPDCTK--VKEDTR--FGDV 1473
            :.|...||...:|...:..|:||..|:|....             |||.:|  |..:|.  ..|.
  Fly   171 QVINGTCPGTFYFKASTAQCDYPQNVECDFVP-------------VPDISKKGVCPETGGFISDN 222

  Fly  1474 KQHNKYYVCL---KGKAVLHY--CSPGNWF 1498
            |..|.||.|.   .|:..|.:  ||.|.:|
  Fly   223 KTCNGYYYCKDLGNGEFSLEHGVCSDGRFF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 17/51 (33%)
CBM_14 1388..1440 CDD:279884 16/51 (31%)
ChtBD2 1459..1505 CDD:214696 17/49 (35%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 2/6 (33%)
ChtBD2 85..130 CDD:214696 17/53 (32%)
CBM_14 146..196 CDD:279884 15/49 (31%)
CBM_14 273..322 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.