DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and obst-F

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:231 Identity:49/231 - (21%)
Similarity:76/231 - (32%) Gaps:81/231 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1266 PNAPKK-----STTSSYTAHPTPKYTTEGNKAETSTLKSPTGTTPGHQEDRTDCSNMPNGIFLRD 1325
            |:.||.     ..||....:|..||                  .|.|.|    |.:. ...||..
  Fly   118 PHKPKPVFVAVDVTSGQPVNPMEKY------------------DPEHIE----CRHY-GAYFLPH 159

  Fly  1326 FQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDC----PLDE---------------- 1370
            .::|..|::|..|......|.|...::.::..|.......|    .:.|                
  Fly   160 PRNCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANS 224

  Fly  1371 -----------------------APENVTKKPSDTESTP--------DCKSLRNGAYVRDPKSCS 1404
                                   :|| :|:.|..|..:|        .|.|.:. :|:..|:.||
  Fly   225 EGAVTVCYIVGSSEYTTLQQFLTSPE-ITELPPVTPPSPPRAEANALTCPSTKQ-SYMSHPEDCS 287

  Fly  1405 RFYVCANGRAIPRQCPQGLHFDIKSNFCNYPILVQC 1440
            ::|:|..|..:...||:||.:|.||.||.....|:|
  Fly   288 KYYICIGGMPVLTSCPKGLFWDQKSGFCEMEKNVKC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 10/51 (20%)
CBM_14 1388..1440 CDD:279884 19/51 (37%)
ChtBD2 1459..1505 CDD:214696
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884 9/41 (22%)
CBM_14 272..321 CDD:279884 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.