DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and obst-J

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster


Alignment Length:221 Identity:51/221 - (23%)
Similarity:80/221 - (36%) Gaps:60/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1305 PGHQEDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIA-GHCPRNLHFDIKRKVCNFPSLV---- 1364
            ||...|.:....:.|.: .|....|.:|..||.|.:.| ..|....:||..|:.| .|..:    
  Fly    79 PGACTDESVFCGLTNSV-ERVQSDCTRYRQCLEGGSFAVAKCSVGNYFDPARRAC-LPVAISAAH 141

  Fly  1365 --DCPLDEAPENVTKKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQCPQGLHFDI 1427
              .|.|   |:|.|                    :.:|..|..::.|.:|:|...|||.|.:||.
  Fly   142 QCSCVL---PDNAT--------------------LANPSDCETYFRCHSGQAELVQCPSGDYFDE 183

  Fly  1428 KSNFC-------------NYPILVQCSLEESQADAHGALLAEGVPDCTKVKEDTRFGDVKQHNKY 1479
            :.:.|             ..|.|.:.:|...:....|:.||....||               .:|
  Fly   184 RVSSCVPDHTGICLEKPTMPPTLTEQALAMDECIRTGSRLAPHSRDC---------------QRY 233

  Fly  1480 YVCLKGKAVLHYCSPGNWFDLRSQKC 1505
            |:|.|.:.:...|..|.:||:..:.|
  Fly   234 YICAKKRVLEMRCPRGQYFDVVRRYC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 14/58 (24%)
CBM_14 1388..1440 CDD:279884 14/64 (22%)
ChtBD2 1459..1505 CDD:214696 10/45 (22%)
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 51/221 (23%)
CBM_14 145..192 CDD:279884 17/69 (25%)
CBM_14 216..259 CDD:279884 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.