DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and obst-H

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:239 Identity:61/239 - (25%)
Similarity:96/239 - (40%) Gaps:56/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1313 DCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDCPLDEAPENVTK 1377
            :|..|.:|.|::.::||..|..|...:::.|.|....:||.:...|:..:.|.|.|||..|    
  Fly    25 ECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTCDIAANVSCFLDEVDE---- 85

  Fly  1378 KPSDTE----------------------STPDCKSLRNGAYVRDP-----------------KSC 1403
             |||.|                      .||....:.|.|.|..|                 .||
  Fly    86 -PSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSC 149

  Fly  1404 SRFYVCANGRAIPRQCPQGLHFDIKSNFCNYPILVQCSLEESQADAHGALLAEGVPDCTKVKEDT 1468
            :.:|:|.:|.|:...|...|:|:..:..|:||..|||:.|:.:  :|..|     |..|:.    
  Fly   150 TNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPR--SHKCL-----PHMTEF---- 203

  Fly  1469 RFGDVKQHNKYYVCLKGKAVLHYCSPGNWFDLRSQKCIDQRLAK 1512
             |......|.:|.|:||...|..|.....:|:..:.|:...:||
  Fly   204 -FPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSCVQIGVAK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 14/51 (27%)
CBM_14 1388..1440 CDD:279884 17/68 (25%)
ChtBD2 1459..1505 CDD:214696 11/45 (24%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 13/50 (26%)
CBM_14 142..184 CDD:279884 12/41 (29%)
ChtBD2 203..240 CDD:214696 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.